Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1145010..1145628 | Replicon | chromosome |
Accession | NZ_CP104521 | ||
Organism | Escherichia coli strain E5 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N5O78_RS05415 | Protein ID | WP_001291435.1 |
Coordinates | 1145010..1145228 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N5O78_RS05420 | Protein ID | WP_000344800.1 |
Coordinates | 1145254..1145628 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O78_RS05380 (1140299) | 1140299..1140871 | + | 573 | WP_000779821.1 | YbaY family lipoprotein | - |
N5O78_RS05385 (1140902) | 1140902..1141213 | - | 312 | WP_000409911.1 | MGMT family protein | - |
N5O78_RS05395 (1141592) | 1141592..1141945 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N5O78_RS05400 (1141987) | 1141987..1143537 | - | 1551 | WP_001317659.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N5O78_RS05405 (1143701) | 1143701..1144171 | - | 471 | WP_000136192.1 | YlaC family protein | - |
N5O78_RS05410 (1144287) | 1144287..1144838 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
N5O78_RS05415 (1145010) | 1145010..1145228 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N5O78_RS05420 (1145254) | 1145254..1145628 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N5O78_RS05425 (1146174) | 1146174..1149323 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
N5O78_RS05430 (1149346) | 1149346..1150539 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258240 WP_001291435.1 NZ_CP104521:c1145228-1145010 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT258240 WP_000344800.1 NZ_CP104521:c1145628-1145254 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |