Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 824047..824845 | Replicon | chromosome |
| Accession | NZ_CP104521 | ||
| Organism | Escherichia coli strain E5 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VRA6 |
| Locus tag | N5O78_RS03930 | Protein ID | WP_000854730.1 |
| Coordinates | 824047..824424 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0P0SQV8 |
| Locus tag | N5O78_RS03935 | Protein ID | WP_001285481.1 |
| Coordinates | 824471..824845 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O78_RS03900 (819845) | 819845..820039 | - | 195 | WP_001313570.1 | DUF957 domain-containing protein | - |
| N5O78_RS03905 (820081) | 820081..820372 | + | 292 | Protein_753 | transposase | - |
| N5O78_RS03910 (820369) | 820369..820719 | + | 351 | WP_000624707.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| N5O78_RS03915 (820750) | 820750..822343 | + | 1594 | Protein_755 | IS66 family transposase | - |
| N5O78_RS03920 (822491) | 822491..823479 | + | 989 | Protein_756 | IS630 family transposase | - |
| N5O78_RS03925 (823558) | 823558..824050 | - | 493 | Protein_757 | DUF5983 family protein | - |
| N5O78_RS03930 (824047) | 824047..824424 | - | 378 | WP_000854730.1 | TA system toxin CbtA family protein | Toxin |
| N5O78_RS03935 (824471) | 824471..824845 | - | 375 | WP_001285481.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5O78_RS03940 (824895) | 824895..825539 | - | 645 | WP_000086759.1 | hypothetical protein | - |
| N5O78_RS03945 (825558) | 825558..825779 | - | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| N5O78_RS03950 (825842) | 825842..826318 | - | 477 | WP_001313574.1 | RadC family protein | - |
| N5O78_RS03955 (826334) | 826334..826807 | - | 474 | WP_001313575.1 | antirestriction protein | - |
| N5O78_RS03960 (826901) | 826901..827146 | - | 246 | WP_001164966.1 | hypothetical protein | - |
| N5O78_RS03965 (827146) | 827146..827967 | - | 822 | WP_001234359.1 | DUF932 domain-containing protein | - |
| N5O78_RS03970 (828067) | 828067..828300 | - | 234 | WP_001213776.1 | DUF905 family protein | - |
| N5O78_RS03975 (828418) | 828418..828870 | - | 453 | WP_000682723.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14212.21 Da Isoelectric Point: 7.2923
>T258239 WP_000854730.1 NZ_CP104521:c824424-824047 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13817.53 Da Isoelectric Point: 4.7511
>AT258239 WP_001285481.1 NZ_CP104521:c824845-824471 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2V671 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P0SQV8 |