Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 477152..477987 | Replicon | chromosome |
Accession | NZ_CP104521 | ||
Organism | Escherichia coli strain E5 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | V0Z9U3 |
Locus tag | N5O78_RS02280 | Protein ID | WP_000854750.1 |
Coordinates | 477610..477987 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | E3PJ72 |
Locus tag | N5O78_RS02275 | Protein ID | WP_001278232.1 |
Coordinates | 477152..477520 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O78_RS02240 (472951) | 472951..473631 | + | 681 | WP_094122466.1 | WYL domain-containing protein | - |
N5O78_RS02245 (473779) | 473779..474456 | + | 678 | WP_094122412.1 | hypothetical protein | - |
N5O78_RS02250 (474462) | 474462..474695 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
N5O78_RS02255 (474794) | 474794..475612 | + | 819 | WP_077737895.1 | DUF932 domain-containing protein | - |
N5O78_RS02260 (475704) | 475704..476189 | + | 486 | WP_000206658.1 | antirestriction protein | - |
N5O78_RS02265 (476205) | 476205..476681 | + | 477 | WP_001367707.1 | RadC family protein | - |
N5O78_RS02270 (476768) | 476768..476989 | + | 222 | WP_000691819.1 | DUF987 domain-containing protein | - |
N5O78_RS02275 (477152) | 477152..477520 | + | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
N5O78_RS02280 (477610) | 477610..477987 | + | 378 | WP_000854750.1 | TA system toxin CbtA family protein | Toxin |
N5O78_RS02285 (477984) | 477984..478472 | + | 489 | WP_000761685.1 | DUF5983 family protein | - |
N5O78_RS02290 (478484) | 478484..478681 | + | 198 | WP_000839280.1 | DUF957 domain-containing protein | - |
N5O78_RS02295 (478766) | 478766..478909 | + | 144 | Protein_441 | hypothetical protein | - |
N5O78_RS02300 (479865) | 479865..481901 | + | 2037 | WP_000417002.1 | hypothetical protein | - |
N5O78_RS02305 (482300) | 482300..482479 | - | 180 | Protein_443 | peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB / fimE | 460721..490210 | 29489 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13919.90 Da Isoelectric Point: 8.2905
>T258238 WP_000854750.1 NZ_CP104521:477610-477987 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|