Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 124023..124666 | Replicon | plasmid p1 |
Accession | NZ_CP104517 | ||
Organism | Escherichia coli strain E4 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | N5O79_RS24930 | Protein ID | WP_001034044.1 |
Coordinates | 124250..124666 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | N5O79_RS24925 | Protein ID | WP_001261286.1 |
Coordinates | 124023..124253 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O79_RS24910 (N5O79_24910) | 119071..121863 | - | 2793 | WP_032492269.1 | hypothetical protein | - |
N5O79_RS24915 (N5O79_24915) | 122125..122822 | + | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
N5O79_RS24920 (N5O79_24920) | 122833..123642 | - | 810 | WP_261307172.1 | hypothetical protein | - |
N5O79_RS24925 (N5O79_24925) | 124023..124253 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N5O79_RS24930 (N5O79_24930) | 124250..124666 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N5O79_RS24935 (N5O79_24935) | 124741..126306 | + | 1566 | WP_261307173.1 | AAA family ATPase | - |
N5O79_RS24940 (N5O79_24940) | 126291..127313 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucB / iucA | 1..146375 | 146375 | |
- | inside | IScluster/Tn | - | - | 122319..128070 | 5751 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T258235 WP_001034044.1 NZ_CP104517:124250-124666 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |