Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 118383..119026 Replicon plasmid p1
Accession NZ_CP104517
Organism Escherichia coli strain E4

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag N5O79_RS24905 Protein ID WP_001034046.1
Coordinates 118610..119026 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag N5O79_RS24900 Protein ID WP_001261278.1
Coordinates 118383..118613 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O79_RS24875 (N5O79_24875) 113882..115453 - 1572 WP_000381395.1 IS66-like element ISCro1 family transposase -
N5O79_RS24880 (N5O79_24880) 115473..115820 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
N5O79_RS24885 (N5O79_24885) 115820..116497 - 678 WP_001682408.1 IS66-like element accessory protein TnpA -
N5O79_RS24890 (N5O79_24890) 116832..117605 - 774 WP_000905949.1 hypothetical protein -
N5O79_RS24895 (N5O79_24895) 117618..118118 - 501 WP_261307171.1 HEPN family nuclease -
N5O79_RS24900 (N5O79_24900) 118383..118613 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5O79_RS24905 (N5O79_24905) 118610..119026 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
N5O79_RS24910 (N5O79_24910) 119071..121863 - 2793 WP_032492269.1 hypothetical protein -
N5O79_RS24915 (N5O79_24915) 122125..122822 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
N5O79_RS24920 (N5O79_24920) 122833..123642 - 810 WP_261307172.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucB / iucA 1..146375 146375
- inside IScluster/Tn - - 122319..128070 5751


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T258234 WP_001034046.1 NZ_CP104517:118610-119026 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT258234 WP_001261278.1 NZ_CP104517:118383-118613 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References