Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 111186..111711 | Replicon | plasmid p1 |
Accession | NZ_CP104517 | ||
Organism | Escherichia coli strain E4 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | N5O79_RS24855 | Protein ID | WP_001159868.1 |
Coordinates | 111186..111491 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | N5O79_RS24860 | Protein ID | WP_000813634.1 |
Coordinates | 111493..111711 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O79_RS24840 (N5O79_24840) | 107082..108248 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
N5O79_RS24845 (N5O79_24845) | 108836..109591 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
N5O79_RS24850 (N5O79_24850) | 110379..111185 | - | 807 | WP_000016982.1 | site-specific integrase | - |
N5O79_RS24855 (N5O79_24855) | 111186..111491 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
N5O79_RS24860 (N5O79_24860) | 111493..111711 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
N5O79_RS24865 (N5O79_24865) | 112303..112791 | + | 489 | WP_011254646.1 | hypothetical protein | - |
N5O79_RS24870 (N5O79_24870) | 112825..113850 | - | 1026 | Protein_119 | hypothetical protein | - |
N5O79_RS24875 (N5O79_24875) | 113882..115453 | - | 1572 | WP_000381395.1 | IS66-like element ISCro1 family transposase | - |
N5O79_RS24880 (N5O79_24880) | 115473..115820 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
N5O79_RS24885 (N5O79_24885) | 115820..116497 | - | 678 | WP_001682408.1 | IS66-like element accessory protein TnpA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucB / iucA | 1..146375 | 146375 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T258233 WP_001159868.1 NZ_CP104517:c111491-111186 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|