Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 4254099..4254682 | Replicon | chromosome |
| Accession | NZ_CP104516 | ||
| Organism | Escherichia coli strain E4 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | N5O79_RS21085 | Protein ID | WP_000254738.1 |
| Coordinates | 4254347..4254682 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | N5O79_RS21080 | Protein ID | WP_000581937.1 |
| Coordinates | 4254099..4254347 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O79_RS21070 (4250438) | 4250438..4251739 | + | 1302 | WP_000046810.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| N5O79_RS21075 (4251787) | 4251787..4254021 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| N5O79_RS21080 (4254099) | 4254099..4254347 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| N5O79_RS21085 (4254347) | 4254347..4254682 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| N5O79_RS21090 (4254753) | 4254753..4255544 | + | 792 | WP_261307030.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| N5O79_RS21095 (4255772) | 4255772..4257409 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| N5O79_RS21100 (4257497) | 4257497..4258795 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4258850..4260178 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T258231 WP_000254738.1 NZ_CP104516:4254347-4254682 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|