Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4128320..4128974 | Replicon | chromosome |
Accession | NZ_CP104516 | ||
Organism | Escherichia coli strain E4 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | N5O79_RS20565 | Protein ID | WP_000244777.1 |
Coordinates | 4128567..4128974 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | N5O79_RS20560 | Protein ID | WP_000354046.1 |
Coordinates | 4128320..4128586 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O79_RS20535 (4123489) | 4123489..4124232 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
N5O79_RS20540 (4124289) | 4124289..4125722 | - | 1434 | WP_140441369.1 | 6-phospho-beta-glucosidase BglA | - |
N5O79_RS20545 (4125767) | 4125767..4126078 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
N5O79_RS20550 (4126242) | 4126242..4126901 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
N5O79_RS20555 (4127097) | 4127097..4128077 | - | 981 | WP_000886083.1 | tRNA-modifying protein YgfZ | - |
N5O79_RS20560 (4128320) | 4128320..4128586 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
N5O79_RS20565 (4128567) | 4128567..4128974 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
N5O79_RS20570 (4129014) | 4129014..4129535 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
N5O79_RS20575 (4129647) | 4129647..4130543 | + | 897 | WP_000806628.1 | site-specific tyrosine recombinase XerD | - |
N5O79_RS20580 (4130568) | 4130568..4131278 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N5O79_RS20585 (4131284) | 4131284..4133017 | + | 1734 | WP_000813201.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T258230 WP_000244777.1 NZ_CP104516:4128567-4128974 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |