Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 2651955..2652756 | Replicon | chromosome |
Accession | NZ_CP104516 | ||
Organism | Escherichia coli strain E4 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | D8EBK0 |
Locus tag | N5O79_RS13475 | Protein ID | WP_001094436.1 |
Coordinates | 2652379..2652756 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | B7MN76 |
Locus tag | N5O79_RS13470 | Protein ID | WP_015953067.1 |
Coordinates | 2651955..2652332 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O79_RS13435 (2647867) | 2647867..2648547 | + | 681 | WP_001593697.1 | WYL domain-containing protein | - |
N5O79_RS13440 (2648695) | 2648695..2649372 | + | 678 | WP_001097312.1 | hypothetical protein | - |
N5O79_RS13445 (2649378) | 2649378..2649611 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
N5O79_RS13450 (2649701) | 2649701..2650519 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
N5O79_RS13455 (2650610) | 2650610..2651095 | + | 486 | WP_000860054.1 | antirestriction protein | - |
N5O79_RS13460 (2651110) | 2651110..2651586 | + | 477 | WP_143365369.1 | RadC family protein | - |
N5O79_RS13465 (2651655) | 2651655..2651876 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
N5O79_RS13470 (2651955) | 2651955..2652332 | + | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
N5O79_RS13475 (2652379) | 2652379..2652756 | + | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
N5O79_RS13480 (2652753) | 2652753..2653241 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
N5O79_RS13485 (2653253) | 2653253..2653450 | + | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
N5O79_RS13490 (2653535) | 2653535..2654380 | + | 846 | WP_001280513.1 | DUF4942 domain-containing protein | - |
N5O79_RS13495 (2654451) | 2654451..2655986 | + | 1536 | WP_000492897.1 | EAL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T258225 WP_001094436.1 NZ_CP104516:2652379-2652756 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT258225 WP_015953067.1 NZ_CP104516:2651955-2652332 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E2L1N0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Z3CIS0 |