Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 2417320..2418134 | Replicon | chromosome |
Accession | NZ_CP104516 | ||
Organism | Escherichia coli strain E4 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | N5O79_RS12250 | Protein ID | WP_001054376.1 |
Coordinates | 2417320..2417577 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | N5O79_RS12255 | Protein ID | WP_001309181.1 |
Coordinates | 2417589..2418134 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O79_RS12225 (2412608) | 2412608..2413714 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
N5O79_RS12230 (2413779) | 2413779..2414759 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
N5O79_RS12235 (2414869) | 2414869..2415074 | + | 206 | Protein_2401 | HNH endonuclease | - |
N5O79_RS12240 (2415342) | 2415342..2416582 | - | 1241 | Protein_2402 | helicase YjhR | - |
N5O79_RS12245 (2416698) | 2416698..2416829 | + | 132 | WP_261307154.1 | GNAT family N-acetyltransferase | - |
N5O79_RS12250 (2417320) | 2417320..2417577 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
N5O79_RS12255 (2417589) | 2417589..2418134 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
N5O79_RS12260 (2418190) | 2418190..2418936 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
N5O79_RS12265 (2419105) | 2419105..2419323 | + | 219 | Protein_2407 | hypothetical protein | - |
N5O79_RS12270 (2419361) | 2419361..2419477 | + | 117 | Protein_2408 | VOC family protein | - |
N5O79_RS12275 (2419722) | 2419722..2420843 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
N5O79_RS12280 (2420840) | 2420840..2421118 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
N5O79_RS12285 (2421130) | 2421130..2422443 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T258224 WP_001054376.1 NZ_CP104516:2417320-2417577 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT258224 WP_001309181.1 NZ_CP104516:2417589-2418134 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|