Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1951876..1952711 | Replicon | chromosome |
| Accession | NZ_CP104516 | ||
| Organism | Escherichia coli strain E4 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7W4PV54 |
| Locus tag | N5O79_RS10020 | Protein ID | WP_000854821.1 |
| Coordinates | 1951876..1952253 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M0D404 |
| Locus tag | N5O79_RS10025 | Protein ID | WP_024214935.1 |
| Coordinates | 1952343..1952711 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O79_RS09985 (1947190) | 1947190..1947495 | + | 306 | WP_000627693.1 | protein YfdT | - |
| N5O79_RS09990 (1947495) | 1947495..1947845 | + | 351 | WP_000433939.1 | helix-turn-helix domain-containing protein | - |
| N5O79_RS09995 (1947767) | 1947767..1948885 | + | 1119 | WP_001132557.1 | tyrosine-type recombinase/integrase | - |
| N5O79_RS10000 (1949112) | 1949112..1950431 | + | 1320 | WP_000144688.1 | site-specific integrase | - |
| N5O79_RS10005 (1950524) | 1950524..1951372 | - | 849 | WP_001280470.1 | DUF4942 domain-containing protein | - |
| N5O79_RS10010 (1951457) | 1951457..1951654 | - | 198 | WP_089075429.1 | DUF957 domain-containing protein | - |
| N5O79_RS10015 (1951682) | 1951682..1951879 | - | 198 | Protein_1968 | DUF5983 family protein | - |
| N5O79_RS10020 (1951876) | 1951876..1952253 | - | 378 | WP_000854821.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| N5O79_RS10025 (1952343) | 1952343..1952711 | - | 369 | WP_024214935.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5O79_RS10030 (1952791) | 1952791..1953012 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| N5O79_RS10035 (1953099) | 1953099..1953575 | - | 477 | WP_001186745.1 | RadC family protein | - |
| N5O79_RS10040 (1953591) | 1953591..1954076 | - | 486 | WP_024214936.1 | antirestriction protein | - |
| N5O79_RS10045 (1954168) | 1954168..1954986 | - | 819 | WP_001234397.1 | DUF932 domain-containing protein | - |
| N5O79_RS10050 (1955076) | 1955076..1955309 | - | 234 | WP_001117566.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13930.95 Da Isoelectric Point: 8.5163
>T258221 WP_000854821.1 NZ_CP104516:c1952253-1951876 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13605.41 Da Isoelectric Point: 6.4659
>AT258221 WP_024214935.1 NZ_CP104516:c1952711-1952343 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7W4PV54 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0D404 |