Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1780072..1780909 | Replicon | chromosome |
Accession | NZ_CP104516 | ||
Organism | Escherichia coli strain E4 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | A0A140NB16 |
Locus tag | N5O79_RS09155 | Protein ID | WP_000227786.1 |
Coordinates | 1780367..1780909 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | N5O79_RS09150 | Protein ID | WP_001297137.1 |
Coordinates | 1780072..1780383 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O79_RS09125 (1775092) | 1775092..1776039 | + | 948 | WP_261307137.1 | cytochrome o ubiquinol oxidase subunit II | - |
N5O79_RS09130 (1776061) | 1776061..1778052 | + | 1992 | WP_261307138.1 | cytochrome o ubiquinol oxidase subunit I | - |
N5O79_RS09135 (1778042) | 1778042..1778656 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
N5O79_RS09140 (1778656) | 1778656..1778985 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
N5O79_RS09145 (1778997) | 1778997..1779887 | + | 891 | WP_000971336.1 | heme o synthase | - |
N5O79_RS09150 (1780072) | 1780072..1780383 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
N5O79_RS09155 (1780367) | 1780367..1780909 | + | 543 | WP_000227786.1 | GNAT family N-acetyltransferase | Toxin |
N5O79_RS09160 (1780965) | 1780965..1781900 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
N5O79_RS09165 (1782317) | 1782317..1783681 | + | 1365 | WP_001000978.1 | MFS transporter | - |
N5O79_RS09170 (1783809) | 1783809..1784300 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
N5O79_RS09175 (1784468) | 1784468..1785379 | + | 912 | WP_000705853.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19794.98 Da Isoelectric Point: 8.3395
>T258220 WP_000227786.1 NZ_CP104516:1780367-1780909 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADSAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADSAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A140NB16 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y6B3 |