Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1745981..1746599 | Replicon | chromosome |
Accession | NZ_CP104516 | ||
Organism | Escherichia coli strain E4 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N5O79_RS08985 | Protein ID | WP_001291435.1 |
Coordinates | 1746381..1746599 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N5O79_RS08980 | Protein ID | WP_000344800.1 |
Coordinates | 1745981..1746355 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O79_RS08970 (1741070) | 1741070..1742263 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N5O79_RS08975 (1742286) | 1742286..1745435 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
N5O79_RS08980 (1745981) | 1745981..1746355 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N5O79_RS08985 (1746381) | 1746381..1746599 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N5O79_RS08990 (1746771) | 1746771..1747322 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
N5O79_RS08995 (1747438) | 1747438..1747908 | + | 471 | WP_000136192.1 | YlaC family protein | - |
N5O79_RS09000 (1748072) | 1748072..1749622 | + | 1551 | WP_261307134.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N5O79_RS09005 (1749664) | 1749664..1750017 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N5O79_RS09015 (1750396) | 1750396..1750707 | + | 312 | WP_000409911.1 | MGMT family protein | - |
N5O79_RS09020 (1750738) | 1750738..1751310 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258219 WP_001291435.1 NZ_CP104516:1746381-1746599 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT258219 WP_000344800.1 NZ_CP104516:1745981-1746355 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |