Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 712612..713250 | Replicon | chromosome |
Accession | NZ_CP104516 | ||
Organism | Escherichia coli strain E4 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N5O79_RS03755 | Protein ID | WP_000813794.1 |
Coordinates | 713074..713250 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N5O79_RS03750 | Protein ID | WP_001270286.1 |
Coordinates | 712612..713028 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O79_RS03730 (707764) | 707764..708705 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
N5O79_RS03735 (708706) | 708706..709719 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
N5O79_RS03740 (709737) | 709737..710882 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
N5O79_RS03745 (711127) | 711127..712533 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
N5O79_RS03750 (712612) | 712612..713028 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N5O79_RS03755 (713074) | 713074..713250 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N5O79_RS03760 (713472) | 713472..713702 | + | 231 | WP_000494244.1 | YncJ family protein | - |
N5O79_RS03765 (713794) | 713794..715755 | - | 1962 | WP_261307095.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N5O79_RS03770 (715828) | 715828..716364 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
N5O79_RS03775 (716456) | 716456..717631 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T258218 WP_000813794.1 NZ_CP104516:c713250-713074 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT258218 WP_001270286.1 NZ_CP104516:c713028-712612 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|