Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 65001..65602 | Replicon | plasmid p1 |
| Accession | NZ_CP104510 | ||
| Organism | Escherichia coli strain E2 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | N5O74_RS26220 | Protein ID | WP_261208802.1 |
| Coordinates | 65222..65602 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | N5O74_RS26215 | Protein ID | WP_001190712.1 |
| Coordinates | 65001..65222 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O74_RS26180 (N5O74_26180) | 60213..60391 | + | 179 | Protein_66 | hypothetical protein | - |
| N5O74_RS26185 (N5O74_26185) | 60725..60859 | + | 135 | Protein_67 | hypothetical protein | - |
| N5O74_RS26190 (N5O74_26190) | 61070..61177 | + | 108 | Protein_68 | hypothetical protein | - |
| N5O74_RS26195 (N5O74_26195) | 62020..62364 | + | 345 | WP_261208886.1 | hypothetical protein | - |
| N5O74_RS26200 (N5O74_26200) | 63423..63779 | - | 357 | WP_001062545.1 | hypothetical protein | - |
| N5O74_RS26205 (N5O74_26205) | 63780..64178 | - | 399 | WP_001648136.1 | hypothetical protein | - |
| N5O74_RS26210 (N5O74_26210) | 64539..64928 | + | 390 | WP_000506724.1 | S24 family peptidase | - |
| N5O74_RS26215 (N5O74_26215) | 65001..65222 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N5O74_RS26220 (N5O74_26220) | 65222..65602 | + | 381 | WP_261208802.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| N5O74_RS26225 (N5O74_26225) | 65607..65786 | + | 180 | WP_001448367.1 | hypothetical protein | - |
| N5O74_RS26230 (N5O74_26230) | 65814..66857 | + | 1044 | WP_000648833.1 | DUF968 domain-containing protein | - |
| N5O74_RS26235 (N5O74_26235) | 66946..67398 | + | 453 | WP_001326849.1 | late promoter-activating protein | - |
| N5O74_RS26240 (N5O74_26240) | 67484..68677 | + | 1194 | WP_261208806.1 | terminase | - |
| N5O74_RS26245 (N5O74_26245) | 68677..70161 | + | 1485 | WP_000124164.1 | terminase | - |
| N5O74_RS26250 (N5O74_26250) | 70375..70476 | + | 102 | Protein_80 | transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul1 / qacE / aac(3)-VIa / ant(3'')-Ia | htpB | 1..124280 | 124280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13587.31 Da Isoelectric Point: 5.1514
>T258205 WP_261208802.1 NZ_CP104510:65222-65602 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRKLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRKLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|