Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 65001..65602 Replicon plasmid p1
Accession NZ_CP104510
Organism Escherichia coli strain E2

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag N5O74_RS26220 Protein ID WP_261208802.1
Coordinates 65222..65602 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag N5O74_RS26215 Protein ID WP_001190712.1
Coordinates 65001..65222 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O74_RS26180 (N5O74_26180) 60213..60391 + 179 Protein_66 hypothetical protein -
N5O74_RS26185 (N5O74_26185) 60725..60859 + 135 Protein_67 hypothetical protein -
N5O74_RS26190 (N5O74_26190) 61070..61177 + 108 Protein_68 hypothetical protein -
N5O74_RS26195 (N5O74_26195) 62020..62364 + 345 WP_261208886.1 hypothetical protein -
N5O74_RS26200 (N5O74_26200) 63423..63779 - 357 WP_001062545.1 hypothetical protein -
N5O74_RS26205 (N5O74_26205) 63780..64178 - 399 WP_001648136.1 hypothetical protein -
N5O74_RS26210 (N5O74_26210) 64539..64928 + 390 WP_000506724.1 S24 family peptidase -
N5O74_RS26215 (N5O74_26215) 65001..65222 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N5O74_RS26220 (N5O74_26220) 65222..65602 + 381 WP_261208802.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N5O74_RS26225 (N5O74_26225) 65607..65786 + 180 WP_001448367.1 hypothetical protein -
N5O74_RS26230 (N5O74_26230) 65814..66857 + 1044 WP_000648833.1 DUF968 domain-containing protein -
N5O74_RS26235 (N5O74_26235) 66946..67398 + 453 WP_001326849.1 late promoter-activating protein -
N5O74_RS26240 (N5O74_26240) 67484..68677 + 1194 WP_261208806.1 terminase -
N5O74_RS26245 (N5O74_26245) 68677..70161 + 1485 WP_000124164.1 terminase -
N5O74_RS26250 (N5O74_26250) 70375..70476 + 102 Protein_80 transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul1 / qacE / aac(3)-VIa / ant(3'')-Ia htpB 1..124280 124280


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13587.31 Da        Isoelectric Point: 5.1514

>T258205 WP_261208802.1 NZ_CP104510:65222-65602 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRKLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT258205 WP_001190712.1 NZ_CP104510:65001-65222 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References