Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2321973..2322611 | Replicon | chromosome |
Accession | NZ_CP104509 | ||
Organism | Escherichia coli strain E2 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N5O74_RS11850 | Protein ID | WP_000813794.1 |
Coordinates | 2321973..2322149 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N5O74_RS11855 | Protein ID | WP_001270286.1 |
Coordinates | 2322195..2322611 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O74_RS11830 (2317592) | 2317592..2318767 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
N5O74_RS11835 (2318859) | 2318859..2319395 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
N5O74_RS11840 (2319468) | 2319468..2321429 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N5O74_RS11845 (2321521) | 2321521..2321751 | - | 231 | WP_000494244.1 | YncJ family protein | - |
N5O74_RS11850 (2321973) | 2321973..2322149 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N5O74_RS11855 (2322195) | 2322195..2322611 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N5O74_RS11860 (2322690) | 2322690..2324096 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
N5O74_RS11865 (2324341) | 2324341..2325486 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
N5O74_RS11870 (2325504) | 2325504..2326517 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
N5O74_RS11875 (2326518) | 2326518..2327459 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T258191 WP_000813794.1 NZ_CP104509:2321973-2322149 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT258191 WP_001270286.1 NZ_CP104509:2322195-2322611 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|