Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 4476..4998 Replicon plasmid p3
Accession NZ_CP104506
Organism Escherichia coli strain E1

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag N5O81_RS26290 Protein ID WP_000220560.1
Coordinates 4717..4998 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag N5O81_RS26285 Protein ID WP_000121743.1
Coordinates 4476..4727 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O81_RS26260 (N5O81_26260) 107..400 + 294 WP_015060510.1 hypothetical protein -
N5O81_RS26265 (N5O81_26265) 402..1370 + 969 WP_077249520.1 IS5-like element IS903B family transposase -
N5O81_RS26270 (N5O81_26270) 1430..1783 - 354 WP_000876434.1 DNA distortion polypeptide 3 -
N5O81_RS26275 (N5O81_26275) 1920..2366 - 447 WP_001074386.1 hypothetical protein -
N5O81_RS26280 (N5O81_26280) 2406..3242 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
N5O81_RS26285 (N5O81_26285) 4476..4727 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
N5O81_RS26290 (N5O81_26290) 4717..4998 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5O81_RS26295 (N5O81_26295) 5144..5467 + 324 WP_001181903.1 hypothetical protein -
N5O81_RS26300 (N5O81_26300) 5512..5757 + 246 WP_000356546.1 hypothetical protein -
N5O81_RS26305 (N5O81_26305) 5747..5962 + 216 WP_001180116.1 hypothetical protein -
N5O81_RS26310 (N5O81_26310) 6055..6384 + 330 WP_000866648.1 hypothetical protein -
N5O81_RS26315 (N5O81_26315) 6671..6820 + 150 WP_000003880.1 hypothetical protein -
N5O81_RS26320 (N5O81_26320) 6833..7105 + 273 WP_000160399.1 hypothetical protein -
N5O81_RS26325 (N5O81_26325) 7432..7977 + 546 WP_038976855.1 DNA distortion polypeptide 1 -
N5O81_RS26330 (N5O81_26330) 7980..9137 + 1158 WP_000538023.1 DNA distortion polypeptide 2 -
N5O81_RS26335 (N5O81_26335) 9498..9989 + 492 WP_000872475.1 transcription termination/antitermination NusG family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-Ia / tet(A) - 1..39219 39219
- flank IS/Tn - - 447..1370 923


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T258182 WP_000220560.1 NZ_CP104506:4717-4998 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT258182 WP_000121743.1 NZ_CP104506:4476-4727 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References