Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4009608..4010158 Replicon chromosome
Accession NZ_CP104503
Organism Escherichia coli strain E1

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag N5O81_RS19440 Protein ID WP_001160966.1
Coordinates 4009844..4010158 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag N5O81_RS19435 Protein ID WP_000125566.1
Coordinates 4009608..4009841 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O81_RS19410 (4004681) 4004681..4004968 + 288 WP_000203741.1 ferredoxin-like protein FixX -
N5O81_RS19415 (4005027) 4005027..4006358 + 1332 WP_001183207.1 MFS transporter -
N5O81_RS19420 (4006466) 4006466..4006996 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
N5O81_RS19425 (4006989) 4006989..4008851 + 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
N5O81_RS19430 (4009043) 4009043..4009522 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
N5O81_RS19435 (4009608) 4009608..4009841 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
N5O81_RS19440 (4009844) 4009844..4010158 + 315 WP_001160966.1 CcdB family protein Toxin
N5O81_RS19445 (4010155) 4010155..4011003 - 849 WP_000257182.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
N5O81_RS19450 (4011010) 4011010..4011387 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
N5O81_RS19455 (4011390) 4011390..4012211 - 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
N5O81_RS19460 (4012208) 4012208..4013197 - 990 WP_000241228.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
N5O81_RS19465 (4013197) 4013197..4014483 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T258174 WP_001160966.1 NZ_CP104503:4009844-4010158 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT258174 WP_000125566.1 NZ_CP104503:4009608-4009841 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References