Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2268590..2269422 | Replicon | chromosome |
| Accession | NZ_CP104503 | ||
| Organism | Escherichia coli strain E1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | N5O81_RS11010 | Protein ID | WP_000854753.1 |
| Coordinates | 2269048..2269422 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | N5O81_RS11005 | Protein ID | WP_001278232.1 |
| Coordinates | 2268590..2268958 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O81_RS10975 (2265426) | 2265426..2265881 | + | 456 | WP_000581504.1 | IrmA family protein | - |
| N5O81_RS10980 (2265960) | 2265960..2266193 | + | 234 | WP_001119729.1 | DUF905 family protein | - |
| N5O81_RS10985 (2266293) | 2266293..2267111 | + | 819 | WP_001520163.1 | DUF932 domain-containing protein | - |
| N5O81_RS10990 (2267166) | 2267166..2267651 | + | 486 | WP_001520165.1 | antirestriction protein | - |
| N5O81_RS10995 (2267667) | 2267667..2268143 | + | 477 | WP_001186726.1 | RadC family protein | - |
| N5O81_RS11000 (2268206) | 2268206..2268427 | + | 222 | WP_000692316.1 | DUF987 domain-containing protein | - |
| N5O81_RS11005 (2268590) | 2268590..2268958 | + | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| N5O81_RS11010 (2269048) | 2269048..2269422 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| N5O81_RS11015 (2269419) | 2269419..2269907 | + | 489 | WP_000777541.1 | DUF5983 family protein | - |
| N5O81_RS11020 (2269919) | 2269919..2270116 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| N5O81_RS11025 (2270213) | 2270213..2270782 | + | 570 | WP_001290241.1 | DUF4942 domain-containing protein | - |
| N5O81_RS11030 (2271124) | 2271124..2271294 | + | 171 | Protein_2165 | IS110 family transposase | - |
| N5O81_RS11035 (2272105) | 2272105..2273088 | + | 984 | WP_001331698.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| N5O81_RS11040 (2273160) | 2273160..2274308 | + | 1149 | WP_000905922.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T258168 WP_000854753.1 NZ_CP104503:2269048-2269422 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT258168 WP_001278232.1 NZ_CP104503:2268590-2268958 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PJ72 |