Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2086108..2086762 | Replicon | chromosome |
| Accession | NZ_CP104503 | ||
| Organism | Escherichia coli strain E1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | N5O81_RS10100 | Protein ID | WP_000244781.1 |
| Coordinates | 2086108..2086515 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N5O81_RS10105 | Protein ID | WP_000354046.1 |
| Coordinates | 2086496..2086762 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O81_RS10080 (2082065) | 2082065..2083798 | - | 1734 | WP_000813193.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N5O81_RS10085 (2083804) | 2083804..2084514 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N5O81_RS10090 (2084539) | 2084539..2085435 | - | 897 | WP_000806633.1 | site-specific tyrosine recombinase XerD | - |
| N5O81_RS10095 (2085547) | 2085547..2086068 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N5O81_RS10100 (2086108) | 2086108..2086515 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| N5O81_RS10105 (2086496) | 2086496..2086762 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N5O81_RS10110 (2087005) | 2087005..2087985 | + | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
| N5O81_RS10115 (2088062) | 2088062..2088721 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| N5O81_RS10120 (2088885) | 2088885..2089196 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| N5O81_RS10125 (2089241) | 2089241..2090674 | + | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T258167 WP_000244781.1 NZ_CP104503:c2086515-2086108 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|