Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1122682..1123272 | Replicon | chromosome |
Accession | NZ_CP104503 | ||
Organism | Escherichia coli strain E1 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | V0VE57 |
Locus tag | N5O81_RS05725 | Protein ID | WP_000373724.1 |
Coordinates | 1122682..1123014 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A3S7DDD0 |
Locus tag | N5O81_RS05730 | Protein ID | WP_000288812.1 |
Coordinates | 1123015..1123272 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O81_RS05705 (1118145) | 1118145..1119407 | + | 1263 | WP_001609141.1 | integrase arm-type DNA-binding domain-containing protein | - |
N5O81_RS05710 (1119546) | 1119546..1120004 | - | 459 | WP_000526101.1 | IS200/IS605-like element IS200C family transposase | - |
N5O81_RS05715 (1120956) | 1120956..1121834 | - | 879 | WP_000511773.1 | integrase domain-containing protein | - |
N5O81_RS05720 (1122213) | 1122213..1122635 | + | 423 | WP_001164104.1 | hypothetical protein | - |
N5O81_RS05725 (1122682) | 1122682..1123014 | - | 333 | WP_000373724.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
N5O81_RS05730 (1123015) | 1123015..1123272 | - | 258 | WP_000288812.1 | antitoxin | Antitoxin |
N5O81_RS05735 (1123370) | 1123370..1123561 | + | 192 | WP_077561361.1 | hypothetical protein | - |
N5O81_RS05740 (1123620) | 1123620..1123826 | - | 207 | WP_000983730.1 | helix-turn-helix transcriptional regulator | - |
N5O81_RS05745 (1123823) | 1123823..1124290 | - | 468 | WP_000201267.1 | hypothetical protein | - |
N5O81_RS05750 (1124523) | 1124523..1125659 | - | 1137 | WP_000420971.1 | ISAs1-like element ISEc1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1106203..1153200 | 46997 | |
- | inside | IScluster/Tn | - | - | 1119546..1125659 | 6113 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11724.57 Da Isoelectric Point: 10.5834
>T258164 WP_000373724.1 NZ_CP104503:c1123014-1122682 [Escherichia coli]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARSGKRLERIPDAVVNEVLARLEAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARSGKRLERIPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0VE57 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S7DDD0 |