Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 84552..85177 | Replicon | plasmid p1 |
Accession | NZ_CP104501 | ||
Organism | Escherichia coli strain E9 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N5O75_RS25530 | Protein ID | WP_000911314.1 |
Coordinates | 84779..85177 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | L4J1D2 |
Locus tag | N5O75_RS25525 | Protein ID | WP_000450532.1 |
Coordinates | 84552..84779 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O75_RS25525 (N5O75_25530) | 84552..84779 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N5O75_RS25530 (N5O75_25535) | 84779..85177 | + | 399 | WP_000911314.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N5O75_RS25535 (N5O75_25540) | 85186..87420 | - | 2235 | WP_089624951.1 | type IV conjugative transfer system coupling protein TraD | - |
N5O75_RS25540 (N5O75_25545) | 87673..88404 | - | 732 | WP_000850423.1 | conjugal transfer complement resistance protein TraT | - |
N5O75_RS25545 (N5O75_25550) | 88418..88927 | - | 510 | WP_086589848.1 | conjugal transfer entry exclusion protein TraS | - |
N5O75_RS25550 (N5O75_25555) | 88924..89328 | - | 405 | Protein_67 | conjugal transfer protein TraG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib | etpB | 1..281548 | 281548 | |
- | flank | IS/Tn | - | - | 89434..90642 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14814.12 Da Isoelectric Point: 7.8604
>T258154 WP_000911314.1 NZ_CP104501:84779-85177 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|