Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4627495..4628330 Replicon chromosome
Accession NZ_CP104500
Organism Escherichia coli strain E9

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag N5O75_RS22960 Protein ID WP_074463759.1
Coordinates 4627953..4628330 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A6Y4TI76
Locus tag N5O75_RS22955 Protein ID WP_072668294.1
Coordinates 4627495..4627863 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O75_RS22915 (4622597) 4622597..4623277 + 681 WP_032082725.1 WYL domain-containing protein -
N5O75_RS22920 (4623425) 4623425..4624102 + 678 WP_089589104.1 hypothetical protein -
N5O75_RS22925 (4624108) 4624108..4624260 + 153 WP_001696589.1 DUF905 family protein -
N5O75_RS22930 (4624361) 4624361..4625179 + 819 WP_261306840.1 DUF932 domain-containing protein -
N5O75_RS22935 (4625518) 4625518..4625997 + 480 WP_032152717.1 antirestriction protein -
N5O75_RS22940 (4626013) 4626013..4626489 + 477 WP_001186771.1 RadC family protein -
N5O75_RS22945 (4626558) 4626558..4626779 + 222 WP_000692295.1 DUF987 domain-containing protein -
N5O75_RS22950 (4626798) 4626798..4627445 + 648 WP_111982093.1 antitoxin of toxin-antitoxin stability system -
N5O75_RS22955 (4627495) 4627495..4627863 + 369 WP_072668294.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N5O75_RS22960 (4627953) 4627953..4628330 + 378 WP_074463759.1 TA system toxin CbtA family protein Toxin
N5O75_RS22965 (4628327) 4628327..4628815 + 489 WP_000761678.1 DUF5983 family protein -
N5O75_RS22970 (4628827) 4628827..4629024 + 198 WP_000839239.1 DUF957 domain-containing protein -
N5O75_RS22975 (4629109) 4629109..4629975 + 867 WP_044311152.1 DUF4942 domain-containing protein -
N5O75_RS22980 (4630047) 4630047..4630310 + 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
N5O75_RS22985 (4630307) 4630307..4630633 + 327 WP_000779482.1 type II toxin-antitoxin system RelE/ParE family toxin -
N5O75_RS22990 (4631516) 4631516..4633054 + 1539 WP_001187171.1 lysine decarboxylation/transport transcriptional activator CadC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4590790..4640777 49987


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14065.14 Da        Isoelectric Point: 8.2830

>T258151 WP_074463759.1 NZ_CP104500:4627953-4628330 [Escherichia coli]
MKTLPDTLVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13843.53 Da        Isoelectric Point: 5.8845

>AT258151 WP_072668294.1 NZ_CP104500:4627495-4627863 [Escherichia coli]
VSDSRHETNYPDDHNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6Y4TI76

References