Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4627495..4628330 | Replicon | chromosome |
| Accession | NZ_CP104500 | ||
| Organism | Escherichia coli strain E9 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | N5O75_RS22960 | Protein ID | WP_074463759.1 |
| Coordinates | 4627953..4628330 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A6Y4TI76 |
| Locus tag | N5O75_RS22955 | Protein ID | WP_072668294.1 |
| Coordinates | 4627495..4627863 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O75_RS22915 (4622597) | 4622597..4623277 | + | 681 | WP_032082725.1 | WYL domain-containing protein | - |
| N5O75_RS22920 (4623425) | 4623425..4624102 | + | 678 | WP_089589104.1 | hypothetical protein | - |
| N5O75_RS22925 (4624108) | 4624108..4624260 | + | 153 | WP_001696589.1 | DUF905 family protein | - |
| N5O75_RS22930 (4624361) | 4624361..4625179 | + | 819 | WP_261306840.1 | DUF932 domain-containing protein | - |
| N5O75_RS22935 (4625518) | 4625518..4625997 | + | 480 | WP_032152717.1 | antirestriction protein | - |
| N5O75_RS22940 (4626013) | 4626013..4626489 | + | 477 | WP_001186771.1 | RadC family protein | - |
| N5O75_RS22945 (4626558) | 4626558..4626779 | + | 222 | WP_000692295.1 | DUF987 domain-containing protein | - |
| N5O75_RS22950 (4626798) | 4626798..4627445 | + | 648 | WP_111982093.1 | antitoxin of toxin-antitoxin stability system | - |
| N5O75_RS22955 (4627495) | 4627495..4627863 | + | 369 | WP_072668294.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5O75_RS22960 (4627953) | 4627953..4628330 | + | 378 | WP_074463759.1 | TA system toxin CbtA family protein | Toxin |
| N5O75_RS22965 (4628327) | 4628327..4628815 | + | 489 | WP_000761678.1 | DUF5983 family protein | - |
| N5O75_RS22970 (4628827) | 4628827..4629024 | + | 198 | WP_000839239.1 | DUF957 domain-containing protein | - |
| N5O75_RS22975 (4629109) | 4629109..4629975 | + | 867 | WP_044311152.1 | DUF4942 domain-containing protein | - |
| N5O75_RS22980 (4630047) | 4630047..4630310 | + | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| N5O75_RS22985 (4630307) | 4630307..4630633 | + | 327 | WP_000779482.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N5O75_RS22990 (4631516) | 4631516..4633054 | + | 1539 | WP_001187171.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4590790..4640777 | 49987 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14065.14 Da Isoelectric Point: 8.2830
>T258151 WP_074463759.1 NZ_CP104500:4627953-4628330 [Escherichia coli]
MKTLPDTLVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTLVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13843.53 Da Isoelectric Point: 5.8845
>AT258151 WP_072668294.1 NZ_CP104500:4627495-4627863 [Escherichia coli]
VSDSRHETNYPDDHNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDSRHETNYPDDHNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|