Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4493412..4494007 | Replicon | chromosome |
Accession | NZ_CP104500 | ||
Organism | Escherichia coli strain E9 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | A0A3L3YDL1 |
Locus tag | N5O75_RS22265 | Protein ID | WP_000239576.1 |
Coordinates | 4493412..4493762 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | N5O75_RS22270 | Protein ID | WP_001223208.1 |
Coordinates | 4493756..4494007 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O75_RS22245 (4488688) | 4488688..4489710 | - | 1023 | WP_001296689.1 | ABC transporter permease | - |
N5O75_RS22250 (4489724) | 4489724..4491226 | - | 1503 | WP_000205795.1 | sugar ABC transporter ATP-binding protein | - |
N5O75_RS22255 (4491536) | 4491536..4492492 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
N5O75_RS22260 (4492802) | 4492802..4493332 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
N5O75_RS22265 (4493412) | 4493412..4493762 | - | 351 | WP_000239576.1 | endoribonuclease toxin ChpB | Toxin |
N5O75_RS22270 (4493756) | 4493756..4494007 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
N5O75_RS22275 (4494219) | 4494219..4494560 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
N5O75_RS22280 (4494563) | 4494563..4498342 | - | 3780 | WP_000060896.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12566.53 Da Isoelectric Point: 6.2232
>T258150 WP_000239576.1 NZ_CP104500:c4493762-4493412 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPIRQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPIRQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L3YDL1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |