Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 4430099..4430800 | Replicon | chromosome |
| Accession | NZ_CP104500 | ||
| Organism | Escherichia coli strain E9 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A3L9JQV5 |
| Locus tag | N5O75_RS21960 | Protein ID | WP_038977124.1 |
| Coordinates | 4430099..4430434 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3L1KVZ6 |
| Locus tag | N5O75_RS21965 | Protein ID | WP_000939437.1 |
| Coordinates | 4430465..4430800 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O75_RS21940 (4426073) | 4426073..4427334 | - | 1262 | Protein_4296 | tyrosine-type recombinase/integrase | - |
| N5O75_RS21945 (4427730) | 4427730..4428677 | - | 948 | WP_038977127.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| N5O75_RS21950 (4428670) | 4428670..4429065 | - | 396 | WP_038977126.1 | DUF6088 family protein | - |
| N5O75_RS21955 (4429135) | 4429135..4429968 | - | 834 | WP_038977125.1 | DUF4942 domain-containing protein | - |
| N5O75_RS21960 (4430099) | 4430099..4430434 | - | 336 | WP_038977124.1 | TA system toxin CbtA family protein | Toxin |
| N5O75_RS21965 (4430465) | 4430465..4430800 | - | 336 | WP_000939437.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5O75_RS21970 (4430800) | 4430800..4431273 | - | 474 | WP_038977123.1 | DNA repair protein RadC | - |
| N5O75_RS21975 (4431303) | 4431303..4432121 | - | 819 | WP_033800492.1 | DUF932 domain-containing protein | - |
| N5O75_RS21980 (4432357) | 4432357..4433310 | - | 954 | WP_038977122.1 | hypothetical protein | - |
| N5O75_RS21985 (4433903) | 4433903..4434517 | + | 615 | WP_000772911.1 | inovirus Gp2 family protein | - |
| N5O75_RS21990 (4434635) | 4434635..4434853 | + | 219 | WP_001064742.1 | AlpA family phage regulatory protein | - |
| N5O75_RS21995 (4435056) | 4435056..4435334 | - | 279 | WP_261306838.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimE / fimB | 4399781..4448968 | 49187 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12802.79 Da Isoelectric Point: 8.9372
>T258149 WP_038977124.1 NZ_CP104500:c4430434-4430099 [Escherichia coli]
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCHNTP
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCHNTP
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3L9JQV5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3L1KVZ6 |