Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3823143..3823980 | Replicon | chromosome |
Accession | NZ_CP104500 | ||
Organism | Escherichia coli strain E9 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | N5O75_RS19140 | Protein ID | WP_000227784.1 |
Coordinates | 3823438..3823980 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | N5O75_RS19135 | Protein ID | WP_001297137.1 |
Coordinates | 3823143..3823454 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O75_RS19110 (3818163) | 3818163..3819110 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
N5O75_RS19115 (3819132) | 3819132..3821123 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
N5O75_RS19120 (3821113) | 3821113..3821727 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
N5O75_RS19125 (3821727) | 3821727..3822056 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
N5O75_RS19130 (3822068) | 3822068..3822958 | + | 891 | WP_000971336.1 | heme o synthase | - |
N5O75_RS19135 (3823143) | 3823143..3823454 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
N5O75_RS19140 (3823438) | 3823438..3823980 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
N5O75_RS19145 (3824036) | 3824036..3824971 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
N5O75_RS19150 (3825379) | 3825379..3826743 | + | 1365 | WP_001000978.1 | MFS transporter | - |
N5O75_RS19155 (3826871) | 3826871..3827362 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
N5O75_RS19160 (3827530) | 3827530..3828441 | + | 912 | WP_000705853.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T258146 WP_000227784.1 NZ_CP104500:3823438-3823980 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|