Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3789065..3789683 | Replicon | chromosome |
| Accession | NZ_CP104500 | ||
| Organism | Escherichia coli strain E9 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | N5O75_RS18970 | Protein ID | WP_001291435.1 |
| Coordinates | 3789465..3789683 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | N5O75_RS18965 | Protein ID | WP_000344800.1 |
| Coordinates | 3789065..3789439 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O75_RS18955 (3784154) | 3784154..3785347 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N5O75_RS18960 (3785370) | 3785370..3788519 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| N5O75_RS18965 (3789065) | 3789065..3789439 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| N5O75_RS18970 (3789465) | 3789465..3789683 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| N5O75_RS18975 (3789855) | 3789855..3790406 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| N5O75_RS18980 (3790522) | 3790522..3790992 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| N5O75_RS18985 (3791156) | 3791156..3792706 | + | 1551 | WP_001364591.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| N5O75_RS18990 (3792748) | 3792748..3793101 | - | 354 | WP_261306832.1 | DUF1428 family protein | - |
| N5O75_RS19000 (3793480) | 3793480..3793791 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| N5O75_RS19005 (3793822) | 3793822..3794394 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258145 WP_001291435.1 NZ_CP104500:3789465-3789683 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT258145 WP_000344800.1 NZ_CP104500:3789065-3789439 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |