Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2336704..2337342 | Replicon | chromosome |
| Accession | NZ_CP104500 | ||
| Organism | Escherichia coli strain E9 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | N5O75_RS11495 | Protein ID | WP_000813794.1 |
| Coordinates | 2336704..2336880 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N5O75_RS11500 | Protein ID | WP_001270285.1 |
| Coordinates | 2336926..2337342 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O75_RS11475 (2332323) | 2332323..2333498 | - | 1176 | WP_001236268.1 | BenE family transporter YdcO | - |
| N5O75_RS11480 (2333590) | 2333590..2334126 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| N5O75_RS11485 (2334199) | 2334199..2336160 | + | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| N5O75_RS11490 (2336252) | 2336252..2336482 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| N5O75_RS11495 (2336704) | 2336704..2336880 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| N5O75_RS11500 (2336926) | 2336926..2337342 | + | 417 | WP_001270285.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| N5O75_RS11505 (2337421) | 2337421..2338827 | + | 1407 | WP_000760594.1 | PLP-dependent aminotransferase family protein | - |
| N5O75_RS11510 (2339072) | 2339072..2340217 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| N5O75_RS11515 (2340235) | 2340235..2341248 | + | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
| N5O75_RS11520 (2341249) | 2341249..2342190 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2331135..2332283 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T258140 WP_000813794.1 NZ_CP104500:2336704-2336880 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15247.61 Da Isoelectric Point: 4.6115
>AT258140 WP_001270285.1 NZ_CP104500:2336926-2337342 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|