Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1405036..1405661 | Replicon | chromosome |
| Accession | NZ_CP104500 | ||
| Organism | Escherichia coli strain E9 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | N5O75_RS06815 | Protein ID | WP_000911329.1 |
| Coordinates | 1405263..1405661 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | N5O75_RS06810 | Protein ID | WP_000450524.1 |
| Coordinates | 1405036..1405263 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O75_RS06785 (1400838) | 1400838..1401308 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| N5O75_RS06790 (1401308) | 1401308..1401880 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| N5O75_RS06795 (1402026) | 1402026..1402904 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| N5O75_RS06800 (1402921) | 1402921..1403955 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| N5O75_RS06805 (1404168) | 1404168..1404881 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| N5O75_RS06810 (1405036) | 1405036..1405263 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| N5O75_RS06815 (1405263) | 1405263..1405661 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N5O75_RS06820 (1405808) | 1405808..1406671 | + | 864 | WP_001267495.1 | neutral zinc metallopeptidase | - |
| N5O75_RS06825 (1406686) | 1406686..1408701 | + | 2016 | WP_000829332.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| N5O75_RS06830 (1408775) | 1408775..1409473 | + | 699 | WP_000679812.1 | esterase | - |
| N5O75_RS06835 (1409583) | 1409583..1409783 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T258138 WP_000911329.1 NZ_CP104500:1405263-1405661 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |