Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 942800..943454 | Replicon | chromosome |
Accession | NZ_CP104500 | ||
Organism | Escherichia coli strain E9 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | N5O75_RS04650 | Protein ID | WP_000244772.1 |
Coordinates | 943047..943454 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | N5O75_RS04645 | Protein ID | WP_000354046.1 |
Coordinates | 942800..943066 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O75_RS04620 (937969) | 937969..938712 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
N5O75_RS04625 (938769) | 938769..940202 | - | 1434 | WP_001307385.1 | 6-phospho-beta-glucosidase BglA | - |
N5O75_RS04630 (940247) | 940247..940558 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
N5O75_RS04635 (940722) | 940722..941381 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
N5O75_RS04640 (941577) | 941577..942557 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
N5O75_RS04645 (942800) | 942800..943066 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
N5O75_RS04650 (943047) | 943047..943454 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
N5O75_RS04655 (943494) | 943494..944015 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
N5O75_RS04660 (944127) | 944127..945023 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
N5O75_RS04665 (945048) | 945048..945758 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N5O75_RS04670 (945764) | 945764..947497 | + | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T258136 WP_000244772.1 NZ_CP104500:943047-943454 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |