Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 831193..832028 | Replicon | chromosome |
Accession | NZ_CP104500 | ||
Organism | Escherichia coli strain E9 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A4V2J0G6 |
Locus tag | N5O75_RS04050 | Protein ID | WP_061360226.1 |
Coordinates | 831193..831570 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A7L7B777 |
Locus tag | N5O75_RS04055 | Protein ID | WP_020218963.1 |
Coordinates | 831660..832028 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O75_RS04025 (827091) | 827091..827627 | + | 537 | WP_038976833.1 | GspM family type II secretion system protein YghD | - |
N5O75_RS04030 (827963) | 827963..829498 | - | 1536 | WP_086589925.1 | EAL domain-containing protein | - |
N5O75_RS04035 (829569) | 829569..830414 | - | 846 | WP_261306901.1 | DUF4942 domain-containing protein | - |
N5O75_RS04040 (830499) | 830499..830696 | - | 198 | WP_000839239.1 | DUF957 domain-containing protein | - |
N5O75_RS04045 (830708) | 830708..831196 | - | 489 | WP_261306855.1 | DUF5983 family protein | - |
N5O75_RS04050 (831193) | 831193..831570 | - | 378 | WP_061360226.1 | TA system toxin CbtA family protein | Toxin |
N5O75_RS04055 (831660) | 831660..832028 | - | 369 | WP_020218963.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N5O75_RS04060 (832078) | 832078..832722 | - | 645 | WP_020218962.1 | hypothetical protein | - |
N5O75_RS04065 (832737) | 832737..832958 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
N5O75_RS04070 (833027) | 833027..833503 | - | 477 | WP_261306856.1 | RadC family protein | - |
N5O75_RS04075 (833518) | 833518..834003 | - | 486 | WP_000214404.1 | antirestriction protein | - |
N5O75_RS04080 (834095) | 834095..834913 | - | 819 | WP_001234380.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14013.95 Da Isoelectric Point: 7.9086
>T258135 WP_061360226.1 NZ_CP104500:c831570-831193 [Escherichia coli]
MKTLPVLPGQAAGSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKQ
MKTLPVLPGQAAGSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13785.49 Da Isoelectric Point: 6.2066
>AT258135 WP_020218963.1 NZ_CP104500:c832028-831660 [Escherichia coli]
VSDSRHETNYPDDHNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDSRHETNYPDDHNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4V2J0G6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7L7B777 |