Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 49331..50129 | Replicon | chromosome |
| Accession | NZ_CP104500 | ||
| Organism | Escherichia coli strain E9 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | U9XMP3 |
| Locus tag | N5O75_RS00255 | Protein ID | WP_000854735.1 |
| Coordinates | 49331..49708 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1EW42 |
| Locus tag | N5O75_RS00260 | Protein ID | WP_032153712.1 |
| Coordinates | 49755..50129 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O75_RS00225 (44693) | 44693..45616 | - | 924 | WP_000535960.1 | carboxylate/amino acid/amine transporter | - |
| N5O75_RS00230 (45727) | 45727..46911 | - | 1185 | WP_001172875.1 | sugar efflux transporter | - |
| N5O75_RS00235 (47308) | 47308..47469 | - | 162 | Protein_46 | virulence RhuM family protein | - |
| N5O75_RS00240 (47707) | 47707..48549 | - | 843 | WP_024166627.1 | DUF4942 domain-containing protein | - |
| N5O75_RS00245 (48634) | 48634..48831 | - | 198 | WP_000839265.1 | DUF957 domain-containing protein | - |
| N5O75_RS00250 (48843) | 48843..49334 | - | 492 | WP_023155722.1 | DUF5983 family protein | - |
| N5O75_RS00255 (49331) | 49331..49708 | - | 378 | WP_000854735.1 | TA system toxin CbtA family protein | Toxin |
| N5O75_RS00260 (49755) | 49755..50129 | - | 375 | WP_032153712.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| N5O75_RS00265 (50209) | 50209..50430 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| N5O75_RS00270 (50499) | 50499..50975 | - | 477 | WP_001186715.1 | RadC family protein | - |
| N5O75_RS00275 (50991) | 50991..51476 | - | 486 | WP_023155724.1 | antirestriction protein | - |
| N5O75_RS00280 (51568) | 51568..52386 | - | 819 | WP_001234693.1 | DUF932 domain-containing protein | - |
| N5O75_RS00285 (52477) | 52477..52686 | - | 210 | WP_023155727.1 | DUF905 family protein | - |
| N5O75_RS00290 (52716) | 52716..53393 | - | 678 | WP_023155728.1 | hypothetical protein | - |
| N5O75_RS00295 (53512) | 53512..54396 | - | 885 | WP_024166630.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14061.07 Da Isoelectric Point: 8.2904
>T258132 WP_000854735.1 NZ_CP104500:c49708-49331 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13697.51 Da Isoelectric Point: 6.6240
>AT258132 WP_032153712.1 NZ_CP104500:c50129-49755 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9XMP3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1EW42 |