Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4228770..4229286 | Replicon | chromosome |
Accession | NZ_CP104491 | ||
Organism | Salmonella enterica strain SalSpp_sample_05_No.1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A5I8HYL8 |
Locus tag | N4229_RS20760 | Protein ID | WP_050068089.1 |
Coordinates | 4228770..4229054 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | N4229_RS20765 | Protein ID | WP_000212724.1 |
Coordinates | 4229044..4229286 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4229_RS20745 (4223887) | 4223887..4225539 | + | 1653 | WP_050068091.1 | alpha,alpha-phosphotrehalase | - |
N4229_RS20750 (4225948) | 4225948..4228086 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N4229_RS20755 (4228302) | 4228302..4228766 | + | 465 | WP_050068090.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N4229_RS20760 (4228770) | 4228770..4229054 | - | 285 | WP_050068089.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4229_RS20765 (4229044) | 4229044..4229286 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N4229_RS20770 (4229364) | 4229364..4231277 | - | 1914 | WP_001212135.1 | BglG family transcription antiterminator | - |
N4229_RS20775 (4231294) | 4231294..4232034 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
N4229_RS20780 (4232031) | 4232031..4233149 | - | 1119 | WP_050068088.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
N4229_RS20785 (4233133) | 4233133..4234266 | - | 1134 | WP_050068087.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10954.79 Da Isoelectric Point: 9.8739
>T258122 WP_050068089.1 NZ_CP104491:c4229054-4228770 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSVRLNDLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSVRLNDLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I8HYL8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |