Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3548097..3548717 | Replicon | chromosome |
Accession | NZ_CP104491 | ||
Organism | Salmonella enterica strain SalSpp_sample_05_No.1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | N4229_RS17615 | Protein ID | WP_001280991.1 |
Coordinates | 3548499..3548717 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | N4229_RS17610 | Protein ID | WP_000344807.1 |
Coordinates | 3548097..3548471 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4229_RS17600 (3543236) | 3543236..3544429 | + | 1194 | WP_050068224.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N4229_RS17605 (3544452) | 3544452..3547601 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
N4229_RS17610 (3548097) | 3548097..3548471 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
N4229_RS17615 (3548499) | 3548499..3548717 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
N4229_RS17620 (3548896) | 3548896..3549447 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
N4229_RS17625 (3549565) | 3549565..3550035 | + | 471 | WP_000136183.1 | YlaC family protein | - |
N4229_RS17630 (3550091) | 3550091..3550231 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
N4229_RS17635 (3550237) | 3550237..3550497 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
N4229_RS17640 (3550722) | 3550722..3552272 | + | 1551 | WP_050068222.1 | EAL domain-containing protein | - |
N4229_RS17645 (3552494) | 3552494..3553216 | - | 723 | WP_050068220.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T258120 WP_001280991.1 NZ_CP104491:3548499-3548717 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT258120 WP_000344807.1 NZ_CP104491:3548097-3548471 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|