Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2407262..2407784 | Replicon | chromosome |
Accession | NZ_CP104491 | ||
Organism | Salmonella enterica strain SalSpp_sample_05_No.1 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | N4229_RS11885 | Protein ID | WP_000221345.1 |
Coordinates | 2407262..2407546 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | N4229_RS11890 | Protein ID | WP_000885424.1 |
Coordinates | 2407536..2407784 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4229_RS11865 (2403337) | 2403337..2404845 | - | 1509 | WP_050067596.1 | FAD-dependent oxidoreductase | - |
N4229_RS11870 (2404890) | 2404890..2405378 | + | 489 | WP_001293637.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
N4229_RS11875 (2405571) | 2405571..2406644 | + | 1074 | WP_050067597.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
N4229_RS11880 (2406702) | 2406702..2407091 | - | 390 | WP_001531585.1 | RidA family protein | - |
N4229_RS11885 (2407262) | 2407262..2407546 | - | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4229_RS11890 (2407536) | 2407536..2407784 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N4229_RS11895 (2408197) | 2408197..2408550 | - | 354 | WP_000418733.1 | hypothetical protein | - |
N4229_RS11900 (2408553) | 2408553..2408942 | - | 390 | WP_001044696.1 | hypothetical protein | - |
N4229_RS11905 (2409307) | 2409307..2409423 | + | 117 | Protein_2332 | IS110 family transposase | - |
N4229_RS11910 (2409915) | 2409915..2410247 | + | 333 | WP_050067598.1 | DUF1493 family protein | - |
N4229_RS11915 (2410398) | 2410398..2411306 | + | 909 | WP_077942333.1 | hypothetical protein | - |
N4229_RS11920 (2411362) | 2411362..2412075 | - | 714 | Protein_2335 | hypothetical protein | - |
N4229_RS11925 (2412461) | 2412461..2412742 | - | 282 | WP_024797870.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2404890..2414494 | 9604 | |
- | flank | IS/Tn | - | - | 2411527..2412066 | 539 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T258114 WP_000221345.1 NZ_CP104491:c2407546-2407262 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |