Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 851170..851795 | Replicon | chromosome |
Accession | NZ_CP104491 | ||
Organism | Salmonella enterica strain SalSpp_sample_05_No.1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N4229_RS04090 | Protein ID | WP_000911337.1 |
Coordinates | 851397..851795 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | N4229_RS04085 | Protein ID | WP_000557545.1 |
Coordinates | 851170..851397 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4229_RS04055 (846216) | 846216..847314 | + | 1099 | WP_010989230.1 | peptide chain release factor 2 | - |
N4229_RS04060 (847324) | 847324..848841 | + | 1518 | WP_050067888.1 | lysine--tRNA ligase | - |
N4229_RS04065 (848917) | 848917..849462 | - | 546 | WP_050067887.1 | isopentenyl-diphosphate Delta-isomerase | - |
N4229_RS04070 (849727) | 849727..850503 | + | 777 | WP_000244321.1 | amidase activator ActS | - |
N4229_RS04080 (850749) | 850749..850961 | - | 213 | WP_024133381.1 | hypothetical protein | - |
N4229_RS04085 (851170) | 851170..851397 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N4229_RS04090 (851397) | 851397..851795 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
N4229_RS04095 (852599) | 852599..853135 | + | 537 | WP_050067886.1 | STM3031 family outer membrane protein | - |
N4229_RS04100 (853182) | 853182..853814 | + | 633 | WP_023208692.1 | YfdX family protein | - |
N4229_RS04105 (854533) | 854533..855126 | + | 594 | WP_047606481.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 850749..860990 | 10241 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T258111 WP_000911337.1 NZ_CP104491:851397-851795 [Salmonella enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|