Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4318974..4319755 | Replicon | chromosome |
Accession | NZ_CP104488 | ||
Organism | Salmonella enterica strain SalSpp_sample_10_No.2 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A752VN12 |
Locus tag | N4232_RS21350 | Protein ID | WP_000622305.1 |
Coordinates | 4318974..4319465 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A3V4SIN7 |
Locus tag | N4232_RS21355 | Protein ID | WP_001110453.1 |
Coordinates | 4319462..4319755 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4232_RS21325 (4314109) | 4314109..4316547 | - | 2439 | WP_001014136.1 | F4 (K88) fimbrial usher FaeD | - |
N4232_RS21330 (4316557) | 4316557..4317096 | - | 540 | WP_000721295.1 | type 1 fimbrial protein | - |
N4232_RS21335 (4317131) | 4317131..4317415 | - | 285 | WP_192917775.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
N4232_RS21340 (4318004) | 4318004..4318231 | + | 228 | WP_001112995.1 | hypothetical protein | - |
N4232_RS21345 (4318506) | 4318506..4318739 | - | 234 | Protein_4179 | IS481 family transposase | - |
N4232_RS21350 (4318974) | 4318974..4319465 | - | 492 | WP_000622305.1 | GNAT family N-acetyltransferase | Toxin |
N4232_RS21355 (4319462) | 4319462..4319755 | - | 294 | WP_001110453.1 | DUF1778 domain-containing protein | Antitoxin |
N4232_RS21360 (4320072) | 4320072..4320294 | + | 223 | Protein_4182 | hypothetical protein | - |
N4232_RS21365 (4320558) | 4320558..4321433 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
N4232_RS21370 (4321430) | 4321430..4321717 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
N4232_RS21375 (4321710) | 4321710..4321892 | - | 183 | WP_001527266.1 | ATP-binding cassette domain-containing protein | - |
N4232_RS21380 (4321912) | 4321912..4322011 | + | 100 | Protein_4186 | hypothetical protein | - |
N4232_RS21385 (4322121) | 4322121..4322255 | + | 135 | Protein_4187 | hypothetical protein | - |
N4232_RS21390 (4322550) | 4322550..4323455 | - | 906 | WP_001268205.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeI / faeH / faeF / faeE / faeD / faeC | 4306468..4321892 | 15424 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17606.43 Da Isoelectric Point: 7.7297
>T258106 WP_000622305.1 NZ_CP104488:c4319465-4318974 [Salmonella enterica]
MISAPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISAPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A752VN12 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIN7 |