Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4110145..4110661 | Replicon | chromosome |
Accession | NZ_CP104488 | ||
Organism | Salmonella enterica strain SalSpp_sample_10_No.2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | N4232_RS20235 | Protein ID | WP_000220578.1 |
Coordinates | 4110145..4110429 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | N4232_RS20240 | Protein ID | WP_000212724.1 |
Coordinates | 4110419..4110661 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4232_RS20220 (4105261) | 4105261..4106913 | + | 1653 | WP_000155039.1 | alpha,alpha-phosphotrehalase | - |
N4232_RS20225 (4107322) | 4107322..4109460 | + | 2139 | WP_000187827.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N4232_RS20230 (4109677) | 4109677..4110141 | + | 465 | WP_001009178.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N4232_RS20235 (4110145) | 4110145..4110429 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4232_RS20240 (4110419) | 4110419..4110661 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N4232_RS20245 (4110739) | 4110739..4112652 | - | 1914 | WP_001212145.1 | BglG family transcription antiterminator | - |
N4232_RS20250 (4112669) | 4112669..4113409 | - | 741 | WP_000779262.1 | KDGP aldolase family protein | - |
N4232_RS20255 (4113406) | 4113406..4114524 | - | 1119 | WP_001139165.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
N4232_RS20260 (4114508) | 4114508..4115641 | - | 1134 | WP_000459952.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T258105 WP_000220578.1 NZ_CP104488:c4110429-4110145 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |