Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4069517..4070067 | Replicon | chromosome |
Accession | NZ_CP104488 | ||
Organism | Salmonella enterica strain SalSpp_sample_10_No.2 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | N4232_RS20030 | Protein ID | WP_001199743.1 |
Coordinates | 4069517..4069825 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A3V9PUN9 |
Locus tag | N4232_RS20035 | Protein ID | WP_000016243.1 |
Coordinates | 4069828..4070067 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4232_RS20020 (4064917) | 4064917..4068432 | - | 3516 | WP_000342548.1 | AAA domain-containing protein | - |
N4232_RS20025 (4068794) | 4068794..4069095 | - | 302 | Protein_3920 | Arm DNA-binding domain-containing protein | - |
N4232_RS20030 (4069517) | 4069517..4069825 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
N4232_RS20035 (4069828) | 4069828..4070067 | - | 240 | WP_000016243.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
N4232_RS20040 (4070176) | 4070176..4070400 | - | 225 | WP_031233173.1 | ribbon-helix-helix protein, CopG family | - |
N4232_RS20050 (4071185) | 4071185..4072204 | + | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
N4232_RS20055 (4072232) | 4072232..4072762 | - | 531 | WP_000896756.1 | gluconokinase | - |
N4232_RS20060 (4072979) | 4072979..4074010 | + | 1032 | WP_000453358.1 | L-idonate 5-dehydrogenase | - |
N4232_RS20065 (4074035) | 4074035..4074799 | + | 765 | WP_000998688.1 | gluconate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T258104 WP_001199743.1 NZ_CP104488:c4069825-4069517 [Salmonella enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V9PUN9 |