Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3393583..3394203 | Replicon | chromosome |
Accession | NZ_CP104488 | ||
Organism | Salmonella enterica strain SalSpp_sample_10_No.2 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | N4232_RS16765 | Protein ID | WP_001280991.1 |
Coordinates | 3393985..3394203 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | N4232_RS16760 | Protein ID | WP_000344807.1 |
Coordinates | 3393583..3393957 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4232_RS16750 (3388722) | 3388722..3389915 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N4232_RS16755 (3389938) | 3389938..3393087 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
N4232_RS16760 (3393583) | 3393583..3393957 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
N4232_RS16765 (3393985) | 3393985..3394203 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
N4232_RS16770 (3394382) | 3394382..3394933 | + | 552 | WP_001278791.1 | maltose O-acetyltransferase | - |
N4232_RS16775 (3395051) | 3395051..3395521 | + | 471 | WP_000136183.1 | YlaC family protein | - |
N4232_RS16780 (3395577) | 3395577..3395717 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
N4232_RS16785 (3395723) | 3395723..3395983 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
N4232_RS16790 (3396208) | 3396208..3397758 | + | 1551 | WP_000213134.1 | EAL domain-containing protein | - |
N4232_RS16800 (3397989) | 3397989..3398378 | + | 390 | WP_000961285.1 | MGMT family protein | - |
N4232_RS16805 (3398411) | 3398411..3398980 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T258103 WP_001280991.1 NZ_CP104488:3393985-3394203 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT258103 WP_000344807.1 NZ_CP104488:3393583-3393957 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|