Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2388681..2389203 | Replicon | chromosome |
Accession | NZ_CP104488 | ||
Organism | Salmonella enterica strain SalSpp_sample_10_No.2 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A5J1ICX1 |
Locus tag | N4232_RS11695 | Protein ID | WP_000221344.1 |
Coordinates | 2388919..2389203 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | N4232_RS11690 | Protein ID | WP_000885424.1 |
Coordinates | 2388681..2388929 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4232_RS11660 (2383850) | 2383850..2384065 | + | 216 | WP_001530185.1 | hypothetical protein | - |
N4232_RS11665 (2384499) | 2384499..2385422 | + | 924 | WP_052940405.1 | hypothetical protein | - |
N4232_RS11670 (2385837) | 2385837..2386412 | + | 576 | Protein_2287 | helix-turn-helix domain-containing protein | - |
N4232_RS11675 (2386483) | 2386483..2387433 | - | 951 | WP_000941990.1 | toll/interleukin-1 receptor domain-containing protein | - |
N4232_RS11680 (2387597) | 2387597..2387929 | - | 333 | WP_000253166.1 | DUF1493 family protein | - |
N4232_RS11685 (2387923) | 2387923..2388381 | - | 459 | WP_000381836.1 | hypothetical protein | - |
N4232_RS11690 (2388681) | 2388681..2388929 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N4232_RS11695 (2388919) | 2388919..2389203 | + | 285 | WP_000221344.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4232_RS11700 (2389322) | 2389322..2389603 | + | 282 | Protein_2293 | RidA family protein | - |
N4232_RS11705 (2389655) | 2389655..2390734 | - | 1080 | WP_000954705.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
N4232_RS11710 (2390927) | 2390927..2391415 | - | 489 | WP_001293633.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
N4232_RS11715 (2391460) | 2391460..2392968 | + | 1509 | WP_000199421.1 | FAD-dependent oxidoreductase | - |
N4232_RS11720 (2392958) | 2392958..2394199 | + | 1242 | WP_001095723.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2382938..2395825 | 12887 | |
- | inside | Genomic island | - | - | 2381550..2395825 | 14275 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11015.73 Da Isoelectric Point: 10.5388
>T258102 WP_000221344.1 NZ_CP104488:2388919-2389203 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTQHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTQHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5J1ICX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |