Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 208869..209629 | Replicon | chromosome |
Accession | NZ_CP104488 | ||
Organism | Salmonella enterica strain SalSpp_sample_10_No.2 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A3V9PR68 |
Locus tag | N4232_RS00990 | Protein ID | WP_000533907.1 |
Coordinates | 209144..209629 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | M7RHS4 |
Locus tag | N4232_RS00985 | Protein ID | WP_000965886.1 |
Coordinates | 208869..209156 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4232_RS00960 (203958) | 203958..204260 | + | 303 | WP_000605592.1 | YsaB family lipoprotein | - |
N4232_RS00965 (204399) | 204399..205310 | + | 912 | WP_001168556.1 | glycine--tRNA ligase subunit alpha | - |
N4232_RS00970 (205320) | 205320..207389 | + | 2070 | WP_001291738.1 | glycine--tRNA ligase subunit beta | - |
N4232_RS00975 (207651) | 207651..208082 | + | 432 | Protein_193 | IS3 family transposase | - |
N4232_RS00980 (208224) | 208224..208691 | + | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
N4232_RS00985 (208869) | 208869..209156 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
N4232_RS00990 (209144) | 209144..209629 | + | 486 | WP_000533907.1 | GNAT family N-acetyltransferase | Toxin |
N4232_RS00995 (210000) | 210000..210539 | - | 540 | WP_000047140.1 | copper-binding periplasmic metallochaperone CueP | - |
N4232_RS01000 (210712) | 210712..210924 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
N4232_RS01005 (211212) | 211212..211502 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
N4232_RS01010 (211941) | 211941..212651 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
N4232_RS01015 (212701) | 212701..213675 | - | 975 | WP_052940425.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
N4232_RS01020 (213905) | 213905..214567 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17715.46 Da Isoelectric Point: 9.8719
>T258096 WP_000533907.1 NZ_CP104488:209144-209629 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALIEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALIEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V9PR68 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V2JDX2 |