Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 38670..39271 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104485 | ||
| Organism | Salmonella enterica strain SalSpp_sample_07_No.3 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | F0JYA5 |
| Locus tag | N4231_RS24545 | Protein ID | WP_001216044.1 |
| Coordinates | 38670..39050 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | N4231_RS24550 | Protein ID | WP_001190712.1 |
| Coordinates | 39050..39271 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4231_RS24510 (N4231_24510) | 34648..34869 | - | 222 | WP_000542336.1 | hypothetical protein | - |
| N4231_RS24520 (N4231_24520) | 36243..36452 | + | 210 | WP_000874154.1 | hypothetical protein | - |
| N4231_RS24525 (N4231_24525) | 36563..37414 | + | 852 | WP_260920959.1 | phage repressor protein C1 | - |
| N4231_RS24530 (N4231_24530) | 37447..37572 | - | 126 | WP_257233066.1 | hypothetical protein | - |
| N4231_RS24535 (N4231_24535) | 37589..38458 | - | 870 | Protein_41 | DUF968 domain-containing protein | - |
| N4231_RS24540 (N4231_24540) | 38486..38665 | - | 180 | WP_039022005.1 | hypothetical protein | - |
| N4231_RS24545 (N4231_24545) | 38670..39050 | - | 381 | WP_001216044.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| N4231_RS24550 (N4231_24550) | 39050..39271 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N4231_RS24555 (N4231_24555) | 39344..39733 | - | 390 | WP_000506730.1 | S24 family peptidase | - |
| N4231_RS24560 (N4231_24560) | 39908..40483 | + | 576 | WP_039022006.1 | hypothetical protein | - |
| N4231_RS24565 (N4231_24565) | 40490..40741 | - | 252 | WP_039022007.1 | DNA polymerase III subunit theta | - |
| N4231_RS24570 (N4231_24570) | 41531..41797 | - | 267 | WP_223671585.1 | hypothetical protein | - |
| N4231_RS24575 (N4231_24575) | 41867..42616 | - | 750 | WP_171841598.1 | hypothetical protein | - |
| N4231_RS24580 (N4231_24580) | 42598..42972 | - | 375 | WP_039022008.1 | hypothetical protein | - |
| N4231_RS24585 (N4231_24585) | 43039..43203 | - | 165 | WP_152950163.1 | hypothetical protein | - |
| N4231_RS24590 (N4231_24590) | 43203..43496 | - | 294 | WP_039022009.1 | hypothetical protein | - |
| N4231_RS24595 (N4231_24595) | 43846..44025 | - | 180 | Protein_53 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | ant(3'')-Ia / lnu(F) / aac(3)-IId / blaTEM-1B / tet(A) | - | 1..82631 | 82631 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13544.28 Da Isoelectric Point: 5.6343
>T258093 WP_001216044.1 NZ_CP104485:c39050-38670 [Salmonella enterica]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6Y6HMN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |