Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 38670..39271 Replicon plasmid unnamed1
Accession NZ_CP104485
Organism Salmonella enterica strain SalSpp_sample_07_No.3

Toxin (Protein)


Gene name doc Uniprot ID F0JYA5
Locus tag N4231_RS24545 Protein ID WP_001216044.1
Coordinates 38670..39050 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag N4231_RS24550 Protein ID WP_001190712.1
Coordinates 39050..39271 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4231_RS24510 (N4231_24510) 34648..34869 - 222 WP_000542336.1 hypothetical protein -
N4231_RS24520 (N4231_24520) 36243..36452 + 210 WP_000874154.1 hypothetical protein -
N4231_RS24525 (N4231_24525) 36563..37414 + 852 WP_260920959.1 phage repressor protein C1 -
N4231_RS24530 (N4231_24530) 37447..37572 - 126 WP_257233066.1 hypothetical protein -
N4231_RS24535 (N4231_24535) 37589..38458 - 870 Protein_41 DUF968 domain-containing protein -
N4231_RS24540 (N4231_24540) 38486..38665 - 180 WP_039022005.1 hypothetical protein -
N4231_RS24545 (N4231_24545) 38670..39050 - 381 WP_001216044.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N4231_RS24550 (N4231_24550) 39050..39271 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N4231_RS24555 (N4231_24555) 39344..39733 - 390 WP_000506730.1 S24 family peptidase -
N4231_RS24560 (N4231_24560) 39908..40483 + 576 WP_039022006.1 hypothetical protein -
N4231_RS24565 (N4231_24565) 40490..40741 - 252 WP_039022007.1 DNA polymerase III subunit theta -
N4231_RS24570 (N4231_24570) 41531..41797 - 267 WP_223671585.1 hypothetical protein -
N4231_RS24575 (N4231_24575) 41867..42616 - 750 WP_171841598.1 hypothetical protein -
N4231_RS24580 (N4231_24580) 42598..42972 - 375 WP_039022008.1 hypothetical protein -
N4231_RS24585 (N4231_24585) 43039..43203 - 165 WP_152950163.1 hypothetical protein -
N4231_RS24590 (N4231_24590) 43203..43496 - 294 WP_039022009.1 hypothetical protein -
N4231_RS24595 (N4231_24595) 43846..44025 - 180 Protein_53 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid ant(3'')-Ia / lnu(F) / aac(3)-IId / blaTEM-1B / tet(A) - 1..82631 82631


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13544.28 Da        Isoelectric Point: 5.6343

>T258093 WP_001216044.1 NZ_CP104485:c39050-38670 [Salmonella enterica]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT258093 WP_001190712.1 NZ_CP104485:c39271-39050 [Salmonella enterica]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6Y6HMN5

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References