Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4411507..4412288 | Replicon | chromosome |
Accession | NZ_CP104484 | ||
Organism | Salmonella enterica strain SalSpp_sample_07_No.3 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | N4231_RS21620 | Protein ID | WP_000626099.1 |
Coordinates | 4411507..4411998 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | N4231_RS21625 | Protein ID | WP_001110452.1 |
Coordinates | 4411995..4412288 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4231_RS21580 (4406693) | 4406693..4406935 | - | 243 | WP_197603740.1 | hypothetical protein | - |
N4231_RS21585 (4406932) | 4406932..4407288 | - | 357 | WP_033567083.1 | hypothetical protein | - |
N4231_RS21590 (4407285) | 4407285..4408157 | - | 873 | WP_033567082.1 | ParA family protein | - |
N4231_RS21595 (4408348) | 4408348..4408425 | - | 78 | Protein_4224 | helix-turn-helix domain-containing protein | - |
N4231_RS21600 (4408516) | 4408516..4408848 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
N4231_RS21605 (4408920) | 4408920..4409297 | + | 378 | WP_000916345.1 | EthD family reductase | - |
N4231_RS21610 (4410330) | 4410330..4410404 | + | 75 | Protein_4227 | porin family protein | - |
N4231_RS21615 (4410507) | 4410507..4411259 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
N4231_RS21620 (4411507) | 4411507..4411998 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
N4231_RS21625 (4411995) | 4411995..4412288 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
N4231_RS21630 (4412605) | 4412605..4412826 | + | 222 | WP_001576552.1 | hypothetical protein | - |
N4231_RS21635 (4413091) | 4413091..4413966 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
N4231_RS21640 (4413963) | 4413963..4414250 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
N4231_RS21645 (4414273) | 4414273..4414488 | + | 216 | WP_001595136.1 | hypothetical protein | - |
N4231_RS21650 (4414496) | 4414496..4414765 | + | 270 | WP_010989096.1 | hypothetical protein | - |
N4231_RS21655 (4415059) | 4415059..4415964 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T258089 WP_000626099.1 NZ_CP104484:c4411998-4411507 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|