Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4201429..4201945 | Replicon | chromosome |
Accession | NZ_CP104484 | ||
Organism | Salmonella enterica strain SalSpp_sample_07_No.3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | N4231_RS20515 | Protein ID | WP_000220578.1 |
Coordinates | 4201429..4201713 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | N4231_RS20520 | Protein ID | WP_000212724.1 |
Coordinates | 4201703..4201945 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4231_RS20500 (4196641) | 4196641..4198293 | + | 1653 | WP_000155057.1 | alpha,alpha-phosphotrehalase | - |
N4231_RS20505 (4198702) | 4198702..4200840 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N4231_RS20510 (4200961) | 4200961..4201425 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N4231_RS20515 (4201429) | 4201429..4201713 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4231_RS20520 (4201703) | 4201703..4201945 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N4231_RS20525 (4202023) | 4202023..4203936 | - | 1914 | WP_001212137.1 | BglG family transcription antiterminator | - |
N4231_RS20530 (4203953) | 4203953..4204693 | - | 741 | WP_000779263.1 | KDGP aldolase family protein | - |
N4231_RS20535 (4204690) | 4204690..4205808 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
N4231_RS20540 (4205792) | 4205792..4206925 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T258088 WP_000220578.1 NZ_CP104484:c4201713-4201429 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |