Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4107168..4107744 | Replicon | chromosome |
Accession | NZ_CP104484 | ||
Organism | Salmonella enterica strain SalSpp_sample_07_No.3 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | N4231_RS20120 | Protein ID | WP_001131963.1 |
Coordinates | 4107457..4107744 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | B5R9R5 |
Locus tag | N4231_RS20115 | Protein ID | WP_000063142.1 |
Coordinates | 4107168..4107470 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4231_RS20100 (4103678) | 4103678..4105828 | + | 2151 | WP_000379927.1 | pyruvate/proton symporter BtsT | - |
N4231_RS20105 (4105923) | 4105923..4106126 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
N4231_RS20110 (4106137) | 4106137..4107093 | + | 957 | WP_000187839.1 | GTPase | - |
N4231_RS20115 (4107168) | 4107168..4107470 | - | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
N4231_RS20120 (4107457) | 4107457..4107744 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
N4231_RS20125 (4108013) | 4108013..4108927 | - | 915 | WP_000290512.1 | restriction endonuclease | - |
N4231_RS20130 (4109125) | 4109125..4112634 | + | 3510 | WP_001043484.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T258087 WP_001131963.1 NZ_CP104484:c4107744-4107457 [Salmonella enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7VD7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7VD7 | |
AlphaFold DB | A0A4D6PB01 |