Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3489594..3490214 | Replicon | chromosome |
| Accession | NZ_CP104484 | ||
| Organism | Salmonella enterica strain SalSpp_sample_07_No.3 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | N4231_RS17250 | Protein ID | WP_001280991.1 |
| Coordinates | 3489996..3490214 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | N4231_RS17245 | Protein ID | WP_000344807.1 |
| Coordinates | 3489594..3489968 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4231_RS17235 (3484733) | 3484733..3485926 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N4231_RS17240 (3485949) | 3485949..3489098 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| N4231_RS17245 (3489594) | 3489594..3489968 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| N4231_RS17250 (3489996) | 3489996..3490214 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| N4231_RS17255 (3490393) | 3490393..3490944 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| N4231_RS17260 (3491061) | 3491061..3491531 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| N4231_RS17265 (3491587) | 3491587..3491727 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| N4231_RS17270 (3491733) | 3491733..3491993 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| N4231_RS17275 (3492218) | 3492218..3493768 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
| N4231_RS17285 (3493999) | 3493999..3494388 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| N4231_RS17290 (3494421) | 3494421..3494990 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T258084 WP_001280991.1 NZ_CP104484:3489996-3490214 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT258084 WP_000344807.1 NZ_CP104484:3489594-3489968 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|