Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4153140..4153656 | Replicon | chromosome |
Accession | NZ_CP104482 | ||
Organism | Salmonella enterica strain SalSpp_sample_08_No.4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | N4230_RS20295 | Protein ID | WP_000220578.1 |
Coordinates | 4153140..4153424 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | N4230_RS20300 | Protein ID | WP_000212724.1 |
Coordinates | 4153414..4153656 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4230_RS20280 (4148352) | 4148352..4150004 | + | 1653 | WP_000155049.1 | alpha,alpha-phosphotrehalase | - |
N4230_RS20285 (4150413) | 4150413..4152551 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N4230_RS20290 (4152672) | 4152672..4153136 | + | 465 | WP_080192018.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N4230_RS20295 (4153140) | 4153140..4153424 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4230_RS20300 (4153414) | 4153414..4153656 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N4230_RS20305 (4153734) | 4153734..4155647 | - | 1914 | WP_001212135.1 | BglG family transcription antiterminator | - |
N4230_RS20310 (4155664) | 4155664..4156404 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
N4230_RS20315 (4156401) | 4156401..4157519 | - | 1119 | WP_001139178.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
N4230_RS20320 (4157503) | 4157503..4158636 | - | 1134 | WP_080192019.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T258070 WP_000220578.1 NZ_CP104482:c4153424-4153140 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |