Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3454996..3455616 | Replicon | chromosome |
| Accession | NZ_CP104482 | ||
| Organism | Salmonella enterica strain SalSpp_sample_08_No.4 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | N4230_RS17080 | Protein ID | WP_001280991.1 |
| Coordinates | 3455398..3455616 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | N4230_RS17075 | Protein ID | WP_000344807.1 |
| Coordinates | 3454996..3455370 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4230_RS17065 (3450135) | 3450135..3451328 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N4230_RS17070 (3451351) | 3451351..3454500 | + | 3150 | WP_260973691.1 | efflux RND transporter permease AcrB | - |
| N4230_RS17075 (3454996) | 3454996..3455370 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| N4230_RS17080 (3455398) | 3455398..3455616 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| N4230_RS17085 (3455795) | 3455795..3456346 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| N4230_RS17090 (3456463) | 3456463..3456933 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| N4230_RS17095 (3456989) | 3456989..3457129 | - | 141 | WP_020839525.1 | type B 50S ribosomal protein L36 | - |
| N4230_RS17100 (3457135) | 3457135..3457395 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| N4230_RS17105 (3457620) | 3457620..3459170 | + | 1551 | WP_080192107.1 | EAL domain-containing protein | - |
| N4230_RS17115 (3459401) | 3459401..3459790 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| N4230_RS17120 (3459823) | 3459823..3460392 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T258067 WP_001280991.1 NZ_CP104482:3455398-3455616 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT258067 WP_000344807.1 NZ_CP104482:3454996-3455370 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|