Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2401920..2402442 | Replicon | chromosome |
Accession | NZ_CP104482 | ||
Organism | Salmonella enterica strain SalSpp_sample_08_No.4 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | N4230_RS11800 | Protein ID | WP_000221343.1 |
Coordinates | 2402158..2402442 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | - |
Locus tag | N4230_RS11795 | Protein ID | WP_080192115.1 |
Coordinates | 2401920..2402168 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4230_RS11765 (2397305) | 2397305..2398771 | + | 1467 | WP_079960978.1 | hypothetical protein | - |
N4230_RS11770 (2399073) | 2399073..2399363 | + | 291 | WP_000742001.1 | hypothetical protein | - |
N4230_RS11775 (2399729) | 2399729..2400464 | + | 736 | Protein_2300 | helix-turn-helix domain-containing protein | - |
N4230_RS11780 (2400520) | 2400520..2400951 | - | 432 | WP_080192144.1 | hypothetical protein | - |
N4230_RS11785 (2401231) | 2401231..2401563 | - | 333 | WP_080192116.1 | DUF1493 family protein | - |
N4230_RS11790 (2401553) | 2401553..2401768 | - | 216 | WP_000206207.1 | hypothetical protein | - |
N4230_RS11795 (2401920) | 2401920..2402168 | + | 249 | WP_080192115.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N4230_RS11800 (2402158) | 2402158..2402442 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4230_RS11805 (2402613) | 2402613..2403002 | + | 390 | WP_000194089.1 | RidA family protein | - |
N4230_RS11810 (2403054) | 2403054..2404133 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
N4230_RS11815 (2404326) | 2404326..2404814 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
N4230_RS11820 (2404859) | 2404859..2406367 | + | 1509 | WP_058214747.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2397308..2409224 | 11916 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T258066 WP_000221343.1 NZ_CP104482:2402158-2402442 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|